PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK12836.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 296aa    MW: 33707.9 Da    PI: 9.7755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK12836.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-0973118447
                      S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 
                      WT eEd+l+ +a   + ++   +W++Ia +++ g++  +++ +++++
        PK12836.1  73 WTREEDKLFEKALVDFSNDlpnRWDRIAGRLP-GKSIPDVIRHYNDL 118
                      ********************************.***********986 PP

2Myb_DNA-binding47.44.3e-15170214347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++++ k++G+g+W++I+r +  +Rt+ q+ s+ qky
        PK12836.1 170 PWTEEEHKLFLKGLKLFGKGDWRSISRNVVITRTPTQVASHAQKY 214
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-569119IPR009057Homeodomain-like
SMARTSM007174.4E-669121IPR001005SANT/Myb domain
SuperFamilySSF466894.76E-1171127IPR009057Homeodomain-like
CDDcd001677.19E-873119No hitNo description
PROSITE profilePS500907.02773119IPR017877Myb-like domain
PfamPF002491.3E-773118IPR001005SANT/Myb domain
PROSITE profilePS5129419.832163219IPR017930Myb domain
SuperFamilySSF466895.8E-17165220IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-16166217IPR006447Myb domain, plants
SMARTSM007175.2E-13167217IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-11167213IPR009057Homeodomain-like
PfamPF002491.4E-13170214IPR001005SANT/Myb domain
CDDcd001674.52E-11170215No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
TQSLVTGDPN LPPNPSNAKS PRKSVSVKKK GKEEEEKISK TQKQFLKIQK TETMFQEARD  60
WNMVTHQPRS TWWTREEDKL FEKALVDFSN DLPNRWDRIA GRLPGKSIPD VIRHYNDLVH  120
DVMEIDSGRV ALPSYTDYSA EGLNGWDSAN QISFGSKAKQ AEPERKKGTP WTEEEHKLFL  180
KGLKLFGKGD WRSISRNVVI TRTPTQVASH AQKYFLRLES GPKERKRSSI HDITTVDGVT  240
DSVPSDQMCL QPTPPPHNSP QQFQTIQQMN PPPNHMTMAT NNHGGSVGYQ HYGFQM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140910.12e-91PREDICTED: transcription factor DIVARICATA
RefseqXP_009341585.12e-91PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H79e-65DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KE732e-91A0A0A0KE73_CUCSA; Syringolide-induced protein 1-3-1B
STRINGGLYMA10G42450.14e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-62MYB family protein